CAT# | AF2173 |
Sequence | ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV |
Activity | Antiparasitic |
Host Chemicals | Psalmopoeus cambridgei | Length | 33 | SwissProt ID | P0C201 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF273 | Temporin-1Ja | Inquiry | ||
AF2625 | Brevinin-2PRe | Inquiry | ||
AF2133 | Brevinin-2-RA6 peptide precursor | Inquiry | ||
AF1486 | Non-specific lipid-transfer protein 1 | Inquiry | ||
AF2435 | Defensin-related cryptdin-9 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...