Home > Product > Antimicrobial Peptides > Psychimicin

Antimicrobial Peptides

Psychimicin

Price Inquiry
CAT#
AF3152
Sequence
INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR
Host Chemicals
Oiketicus kirbyi
Length
45
Activity
Antibacterial, Antifungal
SwissProt ID
P83421

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.