Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C186H313N53O44S2 |
M.W/Mr. | 4059.99 |
Sequence | TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL |
Length | 34 |
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.