Home > Product > Catalog Peptides > Others > pTH-Related Protein Splice Isoform 3 (140-173) (human)

Others

pTH-Related Protein Splice Isoform 3 (140-173) (human)

Price Inquiry
CAT#
P03028
Sequence
TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL
M.W/Mr.
4059.99
Molecular Formula
C186H313N53O44S2
Length
34

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.