Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C186H313N53O44S2 |
M.W/Mr. | 4059.99 |
Sequence | TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL |
Length | 34 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.