CAT# | P03028 |
M.F/Formula | C186H313N53O44S2 |
M.W/Mr. | 4059.99 |
Sequence | TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL |
Length | 34 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P03033 | (Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat) | Inquiry | ||
P03021 | (Tyr52,Asp76)-pTH (52-84) (human) | Inquiry | ||
P03038 | pTH (2-38) (human) | Inquiry | ||
P03055 | Hypercalcemia Malignancy Factor (1-34), amide, human | Inquiry | ||
P03009 | (Tyr27)-pTH (27-48) (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...