Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GFGCPGNQLKCNNHCKSISCRAGYCDAATLWLRCTCTDCNGKK |
Activity | Antibacterial, Antifungal |
Host Chemicals | Crassostrea gigas |
Length | 43 |
SwissProt ID | Q4GWV4 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
3. Emu oil in combination with other active ingredients for treating skin imperfections
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.