This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4104.1 |
Sequence | One Letter Code: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP Three Letter Code: H-Gly-Phe-Cys-Pro-Asp-His-Lys-Ala-Ala-Met-Val-Leu-Phe-Leu-Asp-Arg-Val-Tyr-Gly-Ile-Glu-Val-Gln-Asp-Phe-Leu-Leu-His-Leu-Leu-Glu-Val-Gly-Phe-Leu-Pro-OH |
References | Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004). |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.