Keywords Search Google Search Search

Sa-AFP2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3270
Sequence	KLCQRPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Activity	Fungi,

CAT#	Product Name	Inquiry
AF584	Rhesus theta defensin-1/3, subunit A precursor	Inquiry
AF447	Alyteserin-2Ma	Inquiry
AF1021	Buforin-2	Inquiry
AF1487	Hymenochirin-5Pd	Inquiry
AF2873	Tachystatin-C	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

Bovine Pancreatic Trypsin Inhibitor (BPTI)-Aprotinin

Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...

Introduction of Pentapeptide-3

Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...

Function of L-Ornithine α-Ketoglutarate Monohydrate in Cerebral Hypoxia

L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	S alba
Length	50
SwissProt ID	SwissProt ID: P26780