This peptide sequence represents residues 395-430 of the RBD (receptor binding domain) identified from the RefSeq (YP_009724390.1) from the spike protein of SARS-CoV-2.
CAT# | S29017 |
Sequence | One Letter Code: VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT Three-Letter Code: H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-OH |
Purity | 95% |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...