SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide.
CAT No: R1667
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a synthetic peptide sequence designed for advanced biochemical research and peptide-based technology development. As a defined peptide, it offers a precise arrangement of amino acid residues, enabling researchers to investigate sequence-specific interactions, structure-function relationships, and molecular recognition events. Its unique composition and length make it a valuable tool for exploring protein-protein interactions, signal transduction pathways, and the functional consequences of post-translational modifications within controlled experimental systems. The synthetic nature of this peptide ensures batch-to-batch consistency, supporting reproducible results in a variety of laboratory applications.
Peptide-protein interaction studies: In molecular biology and biochemistry, synthetic peptides such as SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS serve as probes for mapping binding sites and characterizing the specificity of protein-protein interactions. By immobilizing the peptide or using it in solution-phase assays, researchers can identify interaction partners, dissect binding affinities, and unravel the molecular determinants governing complex formation. This approach is instrumental in elucidating the roles of individual residues within larger protein networks, ultimately contributing to a deeper understanding of cellular signaling cascades and regulatory mechanisms.
Antibody epitope mapping: The defined sequence of this peptide allows it to be used as an antigenic probe for epitope mapping in immunological research. By presenting the peptide to monoclonal or polyclonal antibodies, scientists can determine the specificity and binding regions of antibody responses. This application supports the development of highly specific immunoassays, aids in antibody validation, and assists in the design of peptide-based immunogens for research purposes. The ability to pinpoint antibody-peptide interactions is crucial for advancing both basic immunology and the creation of robust analytical tools.
Enzyme substrate studies: Synthetic peptides are frequently employed as model substrates to investigate the activity and specificity of proteases, kinases, and other peptide-modifying enzymes. The sequence of SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS can be tailored to include recognition motifs for particular enzymes, enabling kinetic analyses, cleavage mapping, and the assessment of post-translational modification events. Such studies are essential for characterizing enzymatic mechanisms, screening for inhibitors, and exploring regulatory pathways that depend on peptide processing.
Peptide structure-function analysis: The defined nature of this peptide facilitates systematic structure-activity relationship (SAR) investigations. By introducing targeted modifications or employing biophysical techniques such as circular dichroism, NMR spectroscopy, or fluorescence assays, researchers can probe conformational properties, folding behavior, and the influence of specific residues on biological activity. These insights are vital for advancing knowledge of peptide stability, aggregation tendencies, and the determinants of molecular recognition.
Peptide-based assay development: The sequence specificity and chemical tractability of SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS support its use in the creation of custom biochemical assays. Whether incorporated into ELISA platforms, used as a capture agent in affinity purification workflows, or deployed in high-throughput screening systems, such peptides enhance assay sensitivity and selectivity. Their versatility enables the development of tailored detection strategies for research applications spanning cellular signaling, protein modification, and biomarker discovery.
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.