Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ALSCGTVNSNLAACIGYLTQNAPLARGCCTGVTNLNNMAXTTP |
Activity | Antifungal |
Host Chemicals | Raphanus sativus |
Length | 43 |
SwissProt ID | P29420 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. Emu oil in combination with other active ingredients for treating skin imperfections
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.