Home > Product > Antimicrobial Peptides > Seed non-specific lipid transfer protein-like

Antimicrobial Peptides

Seed non-specific lipid transfer protein-like

Price Inquiry
CAT#
AF2976
Sequence
ALSCGTVNSNLAACIGYLTQNAPLARGCCTGVTNLNNMAXTTP
Host Chemicals
Raphanus sativus
Length
43
Activity
Antifungal
SwissProt ID
P29420

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.