Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | EKECTPGETKKLDCNTCFCSDSGIWGCTLMGCRTYTLQPAPTPGEEATRV |
Length | 50 |
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.