CAT# | P15015 |
Sequence | EKECTPGETKKLDCNTCFCSDSGIWGCTLMGCRTYTLQPAPTPGEEATRV |
Length | 50 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P15001 | PI1 | Inquiry | ||
P15003 | protease inhibitor PI-6 | Inquiry | ||
P15005 | protease inhibitor PI-8 | Inquiry | ||
P15018 | serine protease inhibitor pi-4Cp | Inquiry | ||
P15013 | protease inhibitor PI-4 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...