Home > Product > Antimicrobial Peptides > Spodomicin

Antimicrobial Peptides

Spodomicin

Price Inquiry
CAT#
AF2858
Sequence
VHVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMECY
Host Chemicals
Spodoptera littoralis
Length
40
Activity
Antifungal
SwissProt ID
P83411

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.