Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR |
Activity | Antimicrobial |
Host Chemicals | Amolops mantzorum |
Length | 44 |
SwissProt ID | E1AXG2 |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.