Keywords Search Google Search Search

Temporin-MT3 antimicrobial peptide precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3122
Sequence	TMKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKR
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF3054	Beta-defensin 107A	Inquiry
AF3019	Astacidin	Inquiry
AF3049	Gallin protein	Inquiry
AF2870	MiAMP2b	Inquiry
AF310	Japonicin-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Brief information and effect of bradykinin

Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...

GIP (gastric inhibitory polypeptide or glucosedependent insulinotropic peptide)

GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

What is GHK and Copper Peptide?

Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Amolops mantzorum
Length	44
SwissProt ID	E1AXG2