Home > Product > Antimicrobial Peptides > Thermophilin 9

Antimicrobial Peptides

Thermophilin 9

Price Inquiry
CAT#
AF2446
Sequence
LSCDEGMLAVGGLGAVGGPWGAAVGVLVGAALYCF
Host Chemicals
Streptococcus thermophilus LMD-9
Length
35
Activity
Antimicrobial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.