Keywords Search Google Search Search

Thermophilin 9

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2446
Sequence	LSCDEGMLAVGGLGAVGGPWGAAVGVLVGAALYCF
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF2171	Callinectin	Inquiry
AF2086	Brevinin-2TR1_2 antimicrobial peptide precursor	Inquiry
AF2090	Brevinin-2-RA16 peptide precursor	Inquiry
AF2913	Anionic antimicrobial peptide 2, partial	Inquiry
AF3149	Opistoporin3	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

Function of trifluoroacetyl tripeptide-2 in human skin

An overview of trifluoroacetyl tripeptide-2 Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Tripeptide-10 Citrulline, a substitute of decorin

An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...

Function of myristoyl pentapeptide-8 in skin and eyelash

Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Streptococcus thermophilus LMD-9
Length	35