TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R).
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₀₂H₃₂₅N₆₁O₅₄S |
M.W/Mr. | 4504.20 |
Sequence | One Letter Code: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP three Letter Code: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro |
Source# | Synthetic |
1. Emu oil in combination with other active ingredients for treating skin imperfections
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.