Keywords Search Google Search Search

[Tyr34] Parathyroid Hormone (7-34), amide, bovine

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03017
M.F/Formula	C156H244N48O40S2
M.W/Mr.	3496.1
Sequence	FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2

CAT#	Product Name	Inquiry
P03011	pTH-Related Protein (67-86) amide (human, bovine, dog, mouse, ovine, rat)	Inquiry
P03033	(Tyr0)-pTH-Related Protein (1-34) (human, mouse, rat)	Inquiry
P03003	Parathyroid Hormone (70-84), human	Inquiry
P03034	(Tyr36)-pTH-Related Protein (1-36) amide (chicken)	Inquiry
P03057	Hypercalcemia Malignancy Factor (1-34), human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

Application of ZIP to block the constitutive activity of PKMζ

Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

GIP (gastric inhibitory polypeptide or glucosedependent insulinotropic peptide)

GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...

Function of mambalgin 1 in inhibiting acid-sensing ion channels

Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: