Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C184H301N57O55 |
M.W/Mr. | 4191.76 |
Sequence | AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2 |
Length | 36 |
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.