Home > Product > Catalog Peptides > Others > (Tyr36)-pTH-Related Protein (1-36) amide (chicken)

Others

(Tyr36)-pTH-Related Protein (1-36) amide (chicken)

Price Inquiry
CAT#
P03034
Sequence
AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2
M.W/Mr.
4191.76
Molecular Formula
C184H301N57O55
Length
36

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.