Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GLPVCGETCFTGTCYTNGCTCDPWPVCTRN |
Activity | Antiviral |
Host Chemicals | Viola hederacea |
Length | 30 |
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.