Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQE |
Activity | Antibacterial, Antifungal |
Host Chemicals | Macadamia integrifolia |
Length | 35 |
SwissProt ID | Q9SPL3 |
1. Myotropic activity of allatostatins in tenebrionid beetles
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.