Vosoritide

Vosoritide is an analogue of CNP. It is a peptide consisting of the amino acids proline and glycine plus the 37 C-terminal amino acids from natural human CNP.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Vosoritide(CAS 1480724-61-5)

CAT No: R1935

CAS No:1480724-61-5

Synonyms/Alias:Vosoritide;Voxzogo;BMN-111;1480724-61-5;BMN 111;Vosoritide [USAN:INN];UNII-7SE5582Q2P;Vosoritide acetate;GTPL9068;7SE5582Q2P;DTXSID001032751;GLXC-15221;

Chemical Name:(4R,10S,16S,19S,22S,28S,31S,34S,37S,40S,43S,49S,52R)-52-[[2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-4-amino-2-[[(2S)-2-[[2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-5-amino-5-oxo-2-[[2-[[(2S)-pyrrolidine-2-carbonyl]amino]acetyl]amino]pentanoyl]amino]-4-carboxybutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carbonyl]amino]-4-oxobutanoyl]amino]propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]hexanoyl]amino]acetyl]amino]propanoyl]amino]-4-oxobutanoyl]amino]hexanoyl]amino]hexanoyl]amino]acetyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]acetyl]amino]-40-(4-aminobutyl)-49-benzyl-28-[(2S)-butan-2-yl]-31-(3-carbamimidamidopropyl)-34-(carboxymethyl)-16,22-bis(hydroxymethyl)-10,37,43-tris(2-methylpropyl)-19-(2-methylsulfanylethyl)-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51-hexadecaoxo-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35,38,41,44,47,50-hexadecazacyclotripentacontane-4-carboxylic acid

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C176H290N56O51S3
M.W/Mr.
4103
Sequence
One Letter Code:PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC
Three Letter Code:H-Pro-Gly-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys(1)-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(1)-OH
Application
Achondroplasia

Vosoritide is a synthetic peptide analog of C-type natriuretic peptide (CNP), designed to mimic the endogenous signaling functions of CNP within biological systems. As a member of the natriuretic peptide family, it plays a pivotal role in modulating endochondral ossification and skeletal growth by activating natriuretic peptide receptor B (NPR-B). Its unique biochemical properties and high specificity for NPR-B make it a valuable research tool for scientists investigating growth regulation, cartilage biology, and peptide signaling pathways. Vosoritide's precise structural design enables reproducible activity in experimental settings, supporting a wide range of studies in developmental biology and peptide pharmacology.

Peptide signaling studies: Vosoritide is widely utilized in laboratory investigations focused on elucidating the mechanisms of natriuretic peptide signaling, particularly those mediated by NPR-B. By serving as a selective agonist, it enables researchers to dissect downstream effects such as cyclic GMP production, modulation of chondrocyte proliferation, and alterations in gene expression profiles related to skeletal development. Its use in cellular and organotypic culture systems allows for controlled exploration of CNP analog activity, facilitating the mapping of signaling cascades relevant to bone growth and tissue homeostasis.

Cartilage and bone biology research: In the context of skeletal tissue studies, this CNP analog provides a robust tool for probing the regulation of chondrocyte differentiation, matrix production, and longitudinal bone growth. Researchers employ it in in vitro and ex vivo models to simulate and manipulate growth plate dynamics, offering insights into the molecular underpinnings of cartilage development and ossification. The ability to modulate NPR-B activity with high specificity makes it suitable for delineating the contributions of natriuretic peptides to skeletal morphogenesis and for identifying potential molecular targets involved in growth regulation.

Peptide structure-activity relationship analysis: Vosoritide's well-characterized sequence and receptor selectivity render it an ideal reference compound for structure-activity relationship (SAR) studies within the natriuretic peptide family. Scientists leverage its properties to compare functional outcomes of sequence modifications, receptor binding affinities, and downstream signaling potency. Such SAR investigations inform the rational design of novel peptide analogs with tailored biological activities, supporting the advancement of peptide engineering and the development of new research tools or molecular probes.

Receptor pharmacology assays: The compound is a preferred reagent in receptor binding and activation studies aimed at characterizing NPR-B function, ligand specificity, and signal transduction mechanisms. Its application in biochemical and cell-based assays enables quantification of receptor-ligand interactions, assessment of cyclic GMP responses, and evaluation of receptor desensitization or internalization phenomena. These pharmacological analyses contribute to a deeper understanding of natriuretic peptide receptor biology and support the development of assay platforms for high-throughput screening or mechanistic research.

Peptide-based assay development: Vosoritide is frequently employed in the development and optimization of peptide-based assays designed to measure natriuretic peptide activity, receptor engagement, or downstream signaling events. Its stability and reproducible activity profile make it a reliable standard or positive control in assay calibration, validation, and comparative studies. By facilitating the establishment of quantitative and qualitative assay systems, it underpins the generation of robust data sets for academic, industrial, and translational research applications related to peptide pharmacology and skeletal biology.

InChI
InChI=1S/C176H290N56O51S3/c1-14-95(10)143-172(280)201-84-138(245)209-125(86-234)168(276)221-113(54-65-284-13)159(267)229-124(85-233)152(260)200-81-135(242)206-114(66-91(2)3)150(258)198-83-140(247)211-128(174(282)283)89-286-285-88-127(170(278)224-118(70-98-34-16-15-17-35-98)151(259)199-80-137(244)207-115(67-92(4)5)162(270)217-108(41-23-29-60-182)155(263)223-117(69-94(8)9)164(272)226-122(75-142(250)251)167(275)219-110(160(268)231-143)44-32-63-193-176(188)189)210-139(246)82-197-149(257)105(38-20-26-57-179)215-169(277)126(87-235)230-163(271)116(68-93(6)7)208-136(243)79-196-147(255)103(36-18-24-55-177)213-153(261)106(39-21-27-58-180)218-166(274)121(74-132(185)239)222-144(252)96(11)203-133(240)77-195-148(256)104(37-19-25-56-178)214-165(273)119(71-99-46-48-101(236)49-47-99)225-156(264)107(40-22-28-59-181)216-154(262)109(43-31-62-192-175(186)187)212-145(253)97(12)204-161(269)120(73-131(184)238)227-171(279)129-45-33-64-232(129)173(281)123(72-100-76-190-90-202-100)228-158(266)112(51-53-141(248)249)220-157(265)111(50-52-130(183)237)205-134(241)78-194-146(254)102-42-30-61-191-102/h15-17,34-35,46-49,76,90-97,102-129,143,191,233-236H,14,18-33,36-45,50-75,77-89,177-182H2,1-13H3,(H2,183,237)(H2,184,238)(H2,185,239)(H,190,202)(H,194,254)(H,195,256)(H,196,255)(H,197,257)(H,198,258)(H,199,259)(H,200,260)(H,201,280)(H,203,240)(H,204,269)(H,205,241)(H,206,242)(H,207,244)(H,208,243)(H,209,245)(H,210,246)(H,211,247)(H,212,253)(H,213,261)(H,214,273)(H,215,277)(H,216,262)(H,217,270)(H,218,274)(H,219,275)(H,220,265)(H,221,276)(H,222,252)(H,223,263)(H,224,278)(H,225,264)(H,226,272)(H,227,279)(H,228,266)(H,229,267)(H,230,271)(H,231,268)(H,248,249)(H,250,251)(H,282,283)(H4,186,187,192)(H4,188,189,193)/t95-,96-,97-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,143-/m0/s1
InChI Key
IGYWDDBBJPSOTG-WBAGYEQSSA-N
Canonical SMILES
CCC(C)C1C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NCC(=O)NC(CSSCC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)CCCNC(=N)N)CC(=O)O)CC(C)C)CCCCN)CC(C)C)CC2=CC=CC=C2)NC(=O)CNC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)CNC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)C(CC(=O)N)NC(=O)C(C)NC(=O)CNC(=O)C(CCCCN)NC(=O)C(CC3=CC=C(C=C3)O)NC(=O)C(CCCCN)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(CC(=O)N)NC(=O)C4CCCN4C(=O)C(CC5=CN=CN5)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)N)NC(=O)CNC(=O)C6CCCN6)C(=O)O)CC(C)C)CO)CCSC)CO
Isomeric SMILES
CC[C@H](C)[C@H]1C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1)CCCNC(=N)N)CC(=O)O)CC(C)C)CCCCN)CC(C)C)CC2=CC=CC=C2)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC3=CC=C(C=C3)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CC5=CN=CN5)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)CNC(=O)[C@@H]6CCCN6)C(=O)O)CC(C)C)CO)CCSC)CO

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Modification ServicesCustom Conjugation ServiceEpitope Mapping ServicesPeptide CDMOPeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers