Keywords Search Google Search Search

VrD1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3214
Sequence	RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
Activity	Fungi, Insects,

CAT#	Product Name	Inquiry
AF2120	Brevinin-2AH1 antimicrobial peptide precursor	Inquiry
AF2269	Odorranain-C6 antimicrobial peptide	Inquiry
AF420	Antifungal protein 1 large subunit	Inquiry
AF1910	Cycloviolacin O1	Inquiry
AF1088	AR-23	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The mechanism and function of acetyl tetrapeptide-2 in human skin

Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...

A synthetic analogue of vasopressin - felypressin

Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Function of Timonacic in Cancer

Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	seeds, Vigna radiata
Length	46
SwissProt ID	PDB ID: 1TI5