CAT# | AF3112 |
Sequence | PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...