Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | PVSRQQCSQRIQGERFNQCRSQMQDGQLQSCCQELQNVEEQCQC |
Activity | Antimicrobial |
Host Chemicals | Taraxacum officinale |
Length | 44 |
SwissProt ID | P86783 |
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.