CAT# | AF2754 |
Sequence | VPYNPPRPGQSKPFPTFPGHGPFNPKTQWPYPLPNPGH |
Activity | Antimicrobial |
Host Chemicals | Bombus terrestris | Length | 38 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2891 | Hepcidin 3 | Inquiry | ||
AF1255 | Brevinin-1SN1 | Inquiry | ||
AF2925 | Cathelicidin-related antimicrobial peptide | Inquiry | ||
AF071 | Non - disulfide - bridged peptide 5.6 | Inquiry | ||
AF1635 | Lantibiotic lacticin-481 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...