Abaecin

Abaecin is a peptide antibiotic originally isolated from honeybee larvae, known for its antimicrobial activity against Gram-positive bacteria. Its structure contains a β-sheet configuration essential for its function. Researchers use Abaecin in studies of innate immune responses and antimicrobial peptide efficacy in combating bacterial infections. Its properties make it useful in developing peptide-based antimicrobial therapies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A26002

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
Sequence
FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH
Length
39

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicescGMP Peptide ServicePeptide CDMOPeptide Modification ServicesPeptide Analysis ServicesCustom Conjugation ServiceEpitope Mapping ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers