CAT# | AF2381 |
Sequence | PPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH |
Activity | Antimicrobial |
Host Chemicals | Bombus impatiens | Length | 34 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF392 | Antimicrobial peptide1 | Inquiry | ||
AF1479 | Winter flounder 4 | Inquiry | ||
AF2406 | Cupiennin-1 | Inquiry | ||
AF005 | Antimicrobial protein 2 | Inquiry | ||
AF644 | Retrocyclin-3 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...