Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist.

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1164
Synonyms/Alias	1-39-Corticotropin (human)(TFA)
M.F/Formula	C₂₀₇H₃₀₈N₅₆O₅₈S.C₂HF₃O₂
M.W/Mr.	4655.16
Sequence	One Letter Code: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF three Letter Code: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe

CAT#	Product Name	Inquiry
R1994	Glutathione oxidized disodium	Inquiry
R1346	Exendin derivative 1	Inquiry
R2036	N-[(6S)-6-Carboxy-6-(glycylamino)hexanoyl]-D-alanyl-D-alanine	Inquiry
R1717	Thymus factor X	Inquiry
R1967	Larazotide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.