Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1164

Synonyms/Alias:1-39-Corticotropin (human)(TFA)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₇H₃₀₈N₅₆O₅₈S.C₂HF₃O₂
M.W/Mr.
4655.16
Sequence
One Letter Code: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
three Letter Code: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a synthetic peptide corresponding to the full-length sequence of human ACTH, a critical polypeptide hormone produced in the anterior pituitary gland. As a key regulator of adrenal cortex function, ACTH stimulates the biosynthesis and secretion of glucocorticoids, mineralocorticoids, and androgens through its interaction with the melanocortin 2 receptor (MC2R). The peptide's sequence and structure are highly conserved across mammalian species, underscoring its central role in the hypothalamic-pituitary-adrenal (HPA) axis and its importance as a research tool for elucidating stress physiology, endocrine signaling, and peptide-receptor dynamics.

Receptor binding studies: In receptor pharmacology and signal transduction research, ACTH (1-39) serves as a gold-standard ligand for characterizing the specificity and affinity of MC2R and related melanocortin receptors. By enabling detailed investigations into receptor activation, downstream second messenger cascades, and ligand-receptor interactions, it supports the development of novel modulators and the elucidation of peptide hormone signaling pathways. Such studies are instrumental in mapping the structural determinants of receptor selectivity and understanding the molecular basis of endocrine communication.

Endocrine function assays: The peptide is widely employed in in vitro and ex vivo assays designed to assess adrenal steroidogenesis and pituitary-adrenal signaling. Through controlled stimulation of cultured adrenal cells or tissue explants, researchers can quantify the synthesis and release of corticosteroids, dissect the mechanisms underlying feedback regulation, and evaluate the effects of genetic or pharmacological perturbations on HPA axis activity. These applications are essential for advancing knowledge of stress adaptation, metabolic control, and hormonal cross-talk.

Peptide structure-activity relationship (SAR) studies: As a full-length, sequence-defined peptide, ACTH (1-39) is a critical reference standard in SAR investigations aimed at mapping the functional domains required for biological activity. By comparing the actions of native ACTH with those of truncated analogs or sequence variants, scientists can pinpoint residues essential for receptor engagement and activation. Such insights facilitate rational peptide design, inform the development of selective agonists or antagonists, and contribute to the broader understanding of peptide hormone evolution.

Immunoassay development: ACTH (1-39) is frequently utilized as a calibrator or antigen in the development and validation of immunoassays targeting endogenous ACTH or related peptides. Its defined sequence and biochemical properties make it suitable for generating standard curves, evaluating assay sensitivity and specificity, and optimizing antibody performance. These immunoanalytical applications are foundational for studies of pituitary function, stress response, and endocrine disorders in preclinical research settings.

Peptide stability and degradation studies: The compound provides a model substrate for investigating peptide stability, proteolytic processing, and degradation pathways in biological matrices. By exposing ACTH (1-39) to various enzymatic or cellular environments, researchers can monitor cleavage patterns, assess peptide half-life, and identify factors influencing degradation. These studies yield valuable data for optimizing peptide formulation, improving storage conditions, and understanding the fate of peptide hormones in complex biological systems.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOcGMP Peptide ServicePeptide Analysis ServicesEpitope Mapping ServicesPeptide Modification ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers