Keywords Search Google Search Search

Agouti-related Protein (AGRP) (25-82), human

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A06003
M.F/Formula	C279H468N80O90S1
M.W/Mr.	6415.39
Sequence	One Letter Code: LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR Three Letter Code: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg
Appearance	White lyophilised solid

CAT#	Product Name	Inquiry
A06007	AGRP fragment (83-132), amide	Inquiry
A06005	AGRP (54-82)	Inquiry
A06004	AGRP (25-51)	Inquiry
A06002	Agouti-related Protein (AGRP) [Tyr0] (54-82), human	Inquiry
A06001	Agouti-related Protein (AGRP) [Tyr0] (25-51) , human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Depreotide in Tumor Receptor Imaging

Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...

The Introduction of Orexin A

Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Linear Heptapeptide Antagonist, GR 94800

GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Storage	Desiccate at -20°C
Solubility	≥100mg/mL in H2O, Limited solubility in DMSO
Shipping Condition	Room temperature in continental US; may vary elsewhere.