Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C279H468N80O90S1 |
M.W/Mr. | 6415.39 |
Sequence | One Letter Code: LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR Three Letter Code: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg |
Appearance | White lyophilised solid |
Long-term Storage Conditions | ≥100mg/mL in H2O, Limited solubility in DMSO |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.