Agouti-related Protein (AGRP) (25-82), human

Agouti-related Protein (AGRP) (25-82), human is a cysteine-rich fragment containing multiple disulfide-forming residues that stabilize defined folds. The sequence is valuable for probing structural determinants of receptor antagonism and surface presentation. Its compact domain supports NMR, modeling, and docking studies. Applications include protein-peptide recognition research and motif engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A06003

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C279H468N80O90S1
M.W/Mr.
6415.39
Sequence
One Letter Code: LAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPR
Three Letter Code: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu-Lys-Lys-Thr-Thr-Ala-Glu-Gln-Ala-Glu-Glu-Asp-Leu-Leu-Gln-Glu-Ala-Gln-Ala-Leu-Ala-Glu-Val-Leu-Asp-Leu-Gln-Asp-Arg-Glu-Pro-Arg
Appearance
White lyophilised solid
Long-term Storage Conditions
≥100mg/mL in H2O, Limited solubility in DMSO
Shipping Condition
Room temperature in continental US; may vary elsewhere.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServiceEpitope Mapping ServicescGMP Peptide ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers