CAT# | A12016 |
M.F/Formula | C167H272N52O53S2 |
M.W/Mr. | 3920.5 |
Sequence | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A12019 | Amylin (14-20) (human) | Inquiry | ||
A12014 | Amylin, human, free acid | Inquiry | ||
A12013 | Amylin (1-37), human, amide | Inquiry | ||
A12006 | Amylin (1-13), human | Inquiry | ||
A12002 | Amylin (20-29), human | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...