Amylin, rat
Online Inquiry
| CAT# | A12016 |
| M.F/Formula | C167H272N52O53S2 |
| M.W/Mr. | 3920.5 |
| Sequence | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| A12018 |
5-FAM-Amylin (mouse, rat) |
|
|
Inquiry |
| A12017 |
Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide |
|
|
Inquiry |
| A12002 |
Amylin (20-29), human |
|
|
Inquiry |
| A12006 |
Amylin (1-13), human |
|
|
Inquiry |
| A12004 |
Amylin(20-29), Islet Amyloid Polypeptide, IAPP (20-29), hamster |
|
|
Inquiry |
Write a review
Ask a question
My Review for Amylin, rat
Required fields are marked with *
×
Ask a Question for Amylin, rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
