Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C167H272N52O53S2 |
M.W/Mr. | 3920.5 |
Sequence | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
Length | 37 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.