β-Amyloid (1-34) is a β-Amyloid peptide consists of 34 amino acid.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₇₀H₂₅₃N₄₇O₅₂ |
M.W/Mr. | 3787.20 |
Sequence | One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL three Letter Code: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu |
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com