β-Amyloid (1-34) is a β-Amyloid peptide consists of 34 amino acid.
Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.F/Formula | C₁₇₀H₂₅₃N₄₇O₅₂ |
M.W/Mr. | 3787.20 |
Sequence | One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL three Letter Code: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.