β-Amyloid 1-34

β-Amyloid (1-34) is a β-Amyloid peptide consists of 34 amino acid.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1777

CAS No:186359-65-9

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₇₀H₂₅₃N₄₇O₅₂
M.W/Mr.
3787.20
Sequence
One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
three Letter Code: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu

β-Amyloid 1-34 is a synthetic peptide fragment derived from the amyloid precursor protein (APP), encompassing amino acid residues 1 through 34 of the β-amyloid sequence. As a truncated form of the full-length amyloid-beta peptide, it is of particular interest in neurodegenerative research, especially in the context of Alzheimer's disease and related amyloidoses. Its biochemical properties, aggregation behavior, and sequence-specific interactions make it a valuable tool for elucidating the molecular mechanisms underlying amyloidogenesis, protein misfolding, and neuronal toxicity. Researchers utilize this peptide to dissect the structural and functional consequences of amyloid processing, as well as to develop and refine analytical techniques for amyloid detection and quantification.

Aggregation studies: β-Amyloid 1-34 is widely used in experimental models to investigate the aggregation kinetics and structural transitions of amyloidogenic peptides. By observing its propensity to form oligomers or fibrils under controlled conditions, scientists can compare its behavior to that of longer or shorter β-amyloid fragments. These studies offer insight into which peptide regions are critical for nucleation, elongation, and the formation of neurotoxic species, thereby contributing to a more nuanced understanding of amyloid pathology.

Neurotoxicity assays: In cellular and biochemical experiments, the 1-34 fragment serves as a tool for assessing the cytotoxic effects of truncated β-amyloid species on neuronal and glial cells. By exposing cultured cells to defined concentrations of this peptide, researchers can examine dose-dependent toxicity, changes in cell viability, and downstream signaling events. Such assays help delineate the specific contribution of shorter amyloid fragments to neurodegenerative processes and offer a platform for screening neuroprotective compounds.

Proteolytic processing research: The peptide is instrumental in studies focused on APP cleavage and the enzymatic pathways that generate various amyloid-beta species. By using β-Amyloid 1-34 as a substrate or as a reference standard, investigators can characterize the activity of secretases and other proteases involved in amyloid metabolism. This approach aids in mapping the sequence specificity of proteolytic enzymes and in understanding the generation and clearance of distinct amyloid fragments in physiological and pathological contexts.

Analytical method development: Due to its defined sequence and biochemical stability, β-Amyloid 1-34 is frequently employed as a calibration standard or reference material in mass spectrometry, HPLC, and immunoassay protocols. Its use enables the optimization and validation of analytical workflows designed to detect, quantify, or characterize amyloid peptides in biological samples. Reliable quantification of amyloid fragments is essential for biomarker discovery, comparative studies, and the assessment of disease progression in preclinical research.

Structure-function relationship studies: The 1-34 peptide fragment provides a model system for probing the structural determinants of amyloid-beta activity. Through techniques such as circular dichroism, NMR spectroscopy, and molecular modeling, researchers can analyze conformational preferences, secondary structure content, and sequence-dependent interactions. These investigations contribute to the identification of motifs responsible for aggregation propensity, receptor binding, or membrane interactions, thereby advancing the broader understanding of amyloid biology and peptide-mediated cellular effects.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers