β-Amyloid (1-42), rat TFA

β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1767
M.F/Formula	C₁₉₉H₃₀₇N₅₃O₅₉S.C₂HF₃O₂
M.W/Mr.	4532.04
Sequence	One Letter Code: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA three Letter Code: Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

CAT#	Product Name	Inquiry
R1609	Peptide T	Inquiry
R2062	SOR-C13	Inquiry
R0855	G-Protein antagonist peptide	Inquiry
R1842	Crotamine	Inquiry
R1417	HEX3	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.