Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | DIAFHEECCNIRTEHKCNRTTVELYCRRYSP |
Length | 31 |
Modifications | N-linked (GlcNAc...) (complex) |
1. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.