Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS |
Length | 37 |
Modifications | Serine amide |
1. Cationic cell-penetrating peptides are potent furin inhibitors
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.