Products
Home > Functional Peptides > Antimicrobial Peptides > Antimicrobial peptide Ar-AMP

If you find Creative Peptides is useful to satisfy your needs, please do not hesitate to contact us!

Antimicrobial peptide Ar-AMP

CAT#
AF1868
Sequence
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
Host Chemicals
Amaranthus retroflexus
Length
30
Activity
Antifungal
SwissProt ID
Q5I2B2

Useful Tools

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry
  • Please enter the code "peptides"

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

Follow us on:

Copyright © 2008 - Creative Peptides. All rights reserved.

USA

Address: 45-16 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

E-Mail:

Europe

Tel: 44-207-097-1828

E-Mail: