Home > Product > Antimicrobial Peptides > Antimicrobial peptide Ar-AMP

Antimicrobial Peptides

Antimicrobial peptide Ar-AMP

Price Inquiry
CAT#
AF1868
Sequence
AGECVQGRCPSGMCCSQFGYCGRGPKYCGR
Host Chemicals
Amaranthus retroflexus
Length
30
Activity
Antifungal
SwissProt ID
Q5I2B2

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.