Home > Product > Antimicrobial Peptides > Antimicrobial peptide Def1-2

Antimicrobial Peptides

Antimicrobial peptide Def1-2

Price Inquiry
CAT#
AF2283
Sequence
SFGGKVGHSACAANCLSMGKAGGRCNGGVCQCR
Host Chemicals
Nasonia vitripennis
Length
33
Activity
Antimicrobial
SwissProt ID
D0EZK5

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.