CAT# | AF2630 |
Sequence | GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...