Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C194H300N54O58S1 |
M.W/Mr. | 4349.0 |
Sequence | DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Length | 40 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.