Home > Product > Catalog Peptides > Others > [Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat

Others

[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat

Price Inquiry
CAT#
P08004
Sequence
HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2
M.W/Mr.
3555.1
Length
30

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.