CAT# | A13302 |
M.W/Mr. | 4513.1 |
Sequence | DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA |
Length | 42 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
CAD-009 | (Glu20)-Amyloid β-Protein (1-42) | Inquiry | ||
A13310 | [Arg6]-beta-Amyloid (1-42), English Mutation | Inquiry | ||
A13273 | [Gln22]-beta-Amyloid (1-40), Dutch Mutation | Inquiry | ||
CAD-003 | (Arg3)-Amyloid β-Protein (1-40) | Inquiry | ||
A13274 | [Lys22]-beta-Amyloid (1-40), Italian Mutation | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...