Home > Product > Antimicrobial Peptides > B-defensin2-like protein 4

Antimicrobial Peptides

B-defensin2-like protein 4

Price Inquiry
CAT#
AF2526
Sequence
NPVTCLRSGAICHPGFCPRRYKHIGVCGVSAIKCCK
Host Chemicals
Macaca mulatta
Length
36
Activity
Antimicrobial
SwissProt ID
B0LFF6

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.