Keywords Search Google Search Search

Bactericidin B-5P

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2553
Sequence	WNPFKELERAGQRVRDAVISAAAVATVGQAAAIARG
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF978	Dermaseptin - H3	Inquiry
AF919	Pis2	Inquiry
AF467	Formaecin-2	Inquiry
AF118	Cn-AMP2	Inquiry
AF391	Preprotemporin-1SKd	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

KAI-1455: A selective ε-protein kinase C activator

KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Function of ecallantide in hereditary angioedema

Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...

Glucagon-like peptide-1 (7-36) amide

The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...

An antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class - Eptifibatide Acetate

Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Manduca sexta
Length	36
SwissProt ID	P14665