CAT# | AF1870 |
Sequence | AKEFGIPAAVAGTVLNVVEAGGWVTTIVSI |
Activity | Antibacterial |
Host Chemicals | Enterococcus faecalis | Length | 30 | SwissProt ID | Q47765 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF609 | [Aba5-14] BTD-2 | Inquiry | ||
AF2101 | OdE1 | Inquiry | ||
AF2944 | CBD-1 | Inquiry | ||
AF2749 | Spheniscin-1 | Inquiry | ||
AF1088 | AR-23 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...