CAT# | AF2757 |
Sequence | YTAKQCLQAIGSCGIAGTGAGAAGGPAGAFVGAXVVXI |
Activity | Antibacterial |
Host Chemicals | Lactobacillus curvatus | Length | 38 | SwissProt ID | P80323 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3337 | Hydramacin-1 | Inquiry | ||
AF1399 | Hepcidin-2 | Inquiry | ||
AF1339 | Winter flounder 1 | Inquiry | ||
AF2187 | OdD1 | Inquiry | ||
AF2348 | Brevinin-2GHa | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...