Potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.
CAT# | R1045 |
CAS | 524962-01-4 |
Background | The scorpion toxin BeKm-1 is unique among a variety of known short scorpion toxins affecting potassium channels in its selective action on ether-a-go-go-related gene (ERG)-type channels. BeKm-1 shares the common molecular scaffold with other short scorpion toxins. The toxin spatial structure resolved by NMR consists of a short α-helix and a triple-stranded antiparallel β-sheet. By toxin mutagenesis study we identified the residues that are important for the binding of BeKm-1 to the human ERG K+ (HERG) channel. The most critical residues (Tyr-11, Lys-18, Arg-20, Lys-23) are located in the α-helix and following loop whereas the "traditional" functional site of other short scorpion toxins is formed by residues from the β-sheet. Thus the unique location of the binding site of BeKm-1 provides its specificity toward the HERG channel. >> Read More |
M.F/Formula | C174H261N51O52S6 |
M.W/Mr. | 4091.65 |
Sequence | RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF(Disulfide bridge: Cys7 and Cys28,Cys13 and Cys33,Cys17 and Cys35) |
Labeling Target | KV11.1 (hERG) channel |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
Growth hormone releasing factor (GRF) (human) acetate is an acetate salt of an amidated synthetic 29-amino acid ...