Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C143H228N38O40S1 |
M.W/Mr. | 3151.7 |
Sequence | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Length | 30 |
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. Emu oil in combination with other active ingredients for treating skin imperfections
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.