Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4214.8 |
Sequence | AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Length | 39 |
1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
2. Cationic cell-penetrating peptides are potent furin inhibitors
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.