CAT# | A13250 |
M.W/Mr. | 4214.8 |
Sequence | AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Length | 39 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A13046 | Beta-Amyloid (12-22) | Inquiry | ||
A13242 | Beta-Amyloid (1-37) | Inquiry | ||
A13245 | Beta-Amyloid (1-39), mouse, rat | Inquiry | ||
A13225 | Beta-Amyloid (1-34), mouse, rat | Inquiry | ||
A13197 | Beta-Amyloid (1-28), mouse, rat | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...