CAT# | AF2826 |
Sequence | EVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR |
Activity | Antibacterial |
Host Chemicals | Bos taurus | Length | 40 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1923 | Cycloviolacin O3 | Inquiry | ||
AF1879 | Antifungal protein | Inquiry | ||
AF2027 | Cycloviolacin O14 | Inquiry | ||
AF3168 | Vicin-like antimicrobial peptide 2c-1 | Inquiry | ||
AF1293 | Brevinin-1E-OG1 antimicrobial peptide | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...