Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ERVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR |
Activity | Antibacterial |
Host Chemicals | Bos taurus |
Length | 41 |
1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.