CAT# | AF2534 |
Sequence | QRYFCRVRGGRCAALTCLPRETQIGRCSVKGRKCCR |
Activity | Antibacterial, Antifungal |
Host Chemicals | Chinchilla lanigera | Length | 36 | SwissProt ID | P83943 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2049 | Bacteriocin leucocin-B | Inquiry | ||
AF2967 | Beta-defensin 13 | Inquiry | ||
AF1639 | Myeloid cathelicidin 2 | Inquiry | ||
AF754 | Antimicrobial peptide odorranain B6 | Inquiry | ||
AF496 | Dybowskin-2CDYa | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...