Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RSHIDIKNGIERCEKVRGMCKTVCDIDEYDYGYCIRWRNQCCI |
Activity | Antibacterial |
Host Chemicals | Mus musculus |
Length | 43 |
SwissProt ID | Q8C1G4 |
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.