Home > Product > Antimicrobial Peptides > Beta-defensin 36

Antimicrobial Peptides

Beta-defensin 36

Price Inquiry
CAT#
AF3162
Sequence
QKCWNLHGKCRHRCSRKESVYVYCTNGKMCCVKPKYQPKPKPWMF
Host Chemicals
Mus musculus
Length
45
Activity
Antibacterial
SwissProt ID
Q8K3U4

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.