Keywords Search Google Search Search

Beta-defensin110

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2897
Sequence	NFEPKYRFERCEKVRGICKTFCDDVEYDYGYCIKWRSQCCV
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF421	Calcitermin	Inquiry
AF2003	Palustrin-Ca	Inquiry
AF2507	WAM1	Inquiry
AF2148	Defensin-3	Inquiry
AF2194	Cycloviolacin Y1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Brief information of insulin

Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...

Function of elcatonin in treatment of osteoporosis

Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...

Function of PM102 for the reversal of heparin anticoagulation

PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...

Function of mambalgin 1 in inhibiting acid-sensing ion channels

Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...

Function of peginesatide in anemia

Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Homo sapiens
Length	41
SwissProt ID	Q30KR0